Domain assignment for gi|238920026|ref|YP_002933541.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 328 Ribokinase-like 9.98e-71 Ribokinase-like 0.0000856 1v1a A: Alignments

Protein Sequence Details

Sequence length 634
Comment kinase, pfkB family [Edwardsiella ictaluri 93-146]
Sequence
MEKQFDVICMGRVAVDLYSQQIGARLEDASGFAKYLGGSSGNVAYGTARQGLRSSMLARVGDEHMGRFLREELRQAGCDTRHLIIDKERLTALVLLGIKDQDTFPLIFYRDNCADMAISADDVDEAYIASSRCLAITGTHLSHPQTREAVLTALGYARRHGVRTVLDIDYRPVLWGLTSLGDGETRFIAADRVSRELQEVLHLFDVIVGTEEEFHIAGGSIDTLQALTQVRRVSPATLVCKRGARGCSVYTDAIPPRLDDGLTVTGVRVAILNVLGAGDAFMSGLLRGYLNDEGWEQSCRYANACGALVVSRHGCSPAMPSKIELDDYLSRERDVPRPDLDPRLNHLHRVTTRRREWSELCVMAFDHRSQLEEMAMQCGASLKRIPVLKTLILQASRAAAQCAGLAGRAGLLCDGTFGQDALNAITGEGWWIGRPIELPGSRPLEMEHGNIGTQLISWPQEHVVKCLVLYHPEDVHALRLAQERSVAEVYRACCQSGHELLLELILPPDMSHSDDLYLRAVSRFYNLGVYPDCWKLPPLSSAGWSALEAIIERRDPHCRGVLILGLDAPAEELRAGFNAAADHAWVKGFAVGRTLFGDAARAWLRQDIDDAQLVARIRDNYLQLIAWWRERGQA

Download

Sequence (FASTA)