Domain assignment for gi|238919998|ref|YP_002933513.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 128 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.22e-34 Glyoxalase I (lactoylglutathione lyase) 0.00000538 1f9z A: Alignments

Protein Sequence Details

Sequence length 135
Comment lactoylglutathione lyase, putative [Edwardsiella ictaluri 93-146]
Sequence
MRVLHTMLRVADLKRSVDFYTQVLGMRLLRTSENEAYKYSLAFVGYGDEEQGAVIELTYNWGVDSYEMGSAFGHIALGVDDVAATVGQIRRAGGNITREAGPVKGGHTIIAFVEDPDGYKIELIENRSASEGLGR

Download

Sequence (FASTA)