Domain assignment for gi|238919991|ref|YP_002933506.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 279 Ribokinase-like 2.46e-76 PfkB-like kinase 0.00000000735 1vi9 A: Alignments

Protein Sequence Details

Sequence length 288
Comment pyridoxal kinase, putative [Edwardsiella ictaluri 93-146]
Sequence
MKNILSIQSHVVFGHAGNSAAVFPMRRMGVNVWPLNTVQFSNHTQYGHWTGSVMPANHLTEIVQGIADIGELTRCNAVLSGYIGSPQQGEHILQIVRQVKQSNPDAWYFCDPVMGHPEKGCIVAPGVAEFFCQQAVACSDIMAPNLLELETLTDRKITSVEEALAASRALIACGPRIVLVKHLHNAGYDRNRFEMLLVTADEAWHIARPLVDFGARQPVGVGDLTSGLLLVNLLKGESLQSALEHVTAAVYEVMLTTQAMGEYELQLVAAQDRIACPQHRYTAQALHG

Download

Sequence (FASTA)