Domain assignment for gi|238919966|ref|YP_002933481.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 204 P-loop containing nucleoside triphosphate hydrolases 1.89e-49 Nitrogenase iron protein-like 0.00000224 1byi A: Alignments

Protein Sequence Details

Sequence length 221
Comment dethiobiotin synthase, putative [Edwardsiella ictaluri 93-146]
Sequence
MLKRVFVTGTDTEVGKTVASRALLQAIQAAGHSAAGYKPIAVGSDETPQGVRNRDAVTLLKASSMVLSYDEVNPVTLREEIANAYTGEALDYGAMSRGLQNMSVKAQHVVVQGTGGWRVLMQDLRPLSEWVVQEQLPVILVVGIKLGCISHAILTAQAIINDGLPFVGWIANRINPGLSHYAETIDALRQKLPAPQLGEIPYLYRPEEKALARYIDLSALD

Download

Sequence (FASTA)