Domain assignment for gi|238919958|ref|YP_002933473.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
19 134 Urease, beta-subunit 1.7e-42 Urease, beta-subunit 0.0000234 1e9y A:106-238 Alignments

Protein Sequence Details

Sequence length 138
Comment urease, beta subunit, putative [Edwardsiella ictaluri 93-146]
Sequence
MTNAKNSKAKVKESNVPVGGLLLKNEDISFNEDKPVVKVRVRNTGDRAVQVGSHFHFFEANRALEFDRSAAYGMRLNIMATTAIRFEPGDEIEVSLIPFGGKRLLYGFNNLLDGWAMSNYGKEAVVEKAIKSGFKFSK

Download

Sequence (FASTA)