Domain assignment for gi|238919920|ref|YP_002933435.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 73 NE0471 N-terminal domain-like 0.00000000000654 NE0471 N-terminal domain-like 0.0067 2auw A:4-87 Alignments

Protein Sequence Details

Sequence length 170
Comment hypothetical protein NT01EI_2024 [Edwardsiella ictaluri 93-146]
Sequence
MLKIIDVDVVGDHVIEVEFSDGFRGRADLAALFSKPPFSAIADFNRFSLTASGVLNWGDAELSADTVRRISKGAVVSASSRALTPENVEAILRQATWESMSEGRPDILQAALRGYAEQLGHADVIKRAGIASRSSAYKTLSPSTNPSFKSLAKISGAILAIVRENNAQHG

Download

Sequence (FASTA)