Domain assignment for gi|238919905|ref|YP_002933420.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 83 RelE-like 1.44e-22 RelE-like 0.051 1wmi A:1-88 Alignments

Protein Sequence Details

Sequence length 93
Comment addiction module toxin, RelE/StbE family [Edwardsiella ictaluri 93-146]
Sequence
MTYKLSFEKRALKEWKKLAPPIQSQLKKKLIERLENPHVPAARLSGRANRYKIKLRSSGYRLVYEVNDSEIILLVIAIGKRADNEVYQAADSR

Download

Sequence (FASTA)