Domain assignment for gi|238919874|ref|YP_002933389.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
7 85 Homeodomain-like 0.00000000179 Recombinase DNA-binding domain 0.064 1gdt A:141-183 Alignments

Protein Sequence Details

Sequence length 112
Comment hypothetical protein NT01EI_1978 [Edwardsiella ictaluri 93-146]
Sequence
MQKTIHKTHDKNYSRRLTAMLMLHRGDRVSDVARTLCCARSSVGHWINWFTLSGVAGLKSLPAGRARRWPFEHICSLLRELVKHAPGDFCYQRSRWSTELMTIKINEITGCQ

Download

Sequence (FASTA)