Domain assignment for gi|238919866|ref|YP_002933381.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
62 108 Homeodomain-like 0.0000000000345 AraC type transcriptional activator 0.0082 1bl0 A:63-124 Alignments

Protein Sequence Details

Sequence length 119
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MVRDKFILKSFSIINLWIANHVHLGIKSADVIAISGYSRSYFLREFELAMGTTLANYIRLERLKLSLQQLEETELRIKEISHALGYPSQSTFCQIFKNQYRVSPSEYRLLCRRSTRLAS

Download

Sequence (FASTA)