Domain assignment for gi|238919839|ref|YP_002933354.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 261 Trypsin-like serine proteases 6.2e-25 Eukaryotic proteases 0.082 1jou A:,B: Alignments

Protein Sequence Details

Sequence length 270
Comment peptidase, putative [Edwardsiella ictaluri 93-146]
Sequence
MRFPALLSITLLLTLWLPYAALADDGLTPYQQRQLFFGHDDRDRVSEVNDWPWNAIGQVETASGNLCTATLIAPRWALTAGHCLLAPPGKTDRAVALRFMSHDGKWRYQSRHLQTQVNPQLHKKLKADGDGWIVPPTAAPQDYGLVEITAGPLPDLRPLPVWQGTPKALSAALKAQRRQVTQAGYPQDHLDILYRHRDCLITGWAQSGVLSHRCDTLPGDSGSPLLMRQATGWTLVAIQSSAPAAENRALADNRAVAVTAINAGLQRLMH

Download

Sequence (FASTA)