Domain assignment for gi|238919799|ref|YP_002933314.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 293 Ribokinase-like 3.27e-51 Ribokinase-like 0.003 1v1a A: Alignments

Protein Sequence Details

Sequence length 313
Comment kinase, PfkB family [Edwardsiella ictaluri 93-146]
Sequence
MTTMRTPRPVAVIGGAVGDLILNLPRLPLRGEDMEAQEGGRTIGGCAFNVARALCRMEIPVINGMPVGNGPWGALAEQAMTALALPVLLRHPQQDNGWCLACVEADGERTFISVSGCETQWSAPLLAQIALPAGALVYLSGYELAGDGGQALCEWMYALPPGCTLLLDPGPRLPHLPETLWQRLPAGSLLTLNRDEITQLCGEGDPVIAASAFAVQRGIHLICRLDAHGAWLCASDGRQRHLPAYPITLADTIGAGDAHCGGVLAGLALGLALEEAIDLGNQVAACVVSQPGPDGAPTRAQLKARFPQAHTRL

Download

Sequence (FASTA)