Domain assignment for gi|238919768|ref|YP_002933283.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 240 EAL domain-like 4.18e-39 EAL domain 0.016 2bas A:2-262 Alignments

Protein Sequence Details

Sequence length 257
Comment cyclic diguanylate phosphodiesterase (EAL) domain protein [Edwardsiella ictaluri 93-146]
Sequence
MQYALATDEFYLEYQPQWNVHGHIQGAELLIRWQHPRYGVLLPDRFMDALMSCQLGPTLFGWLAERALPLLQRLRNEVTPDFTLSLALPLGLAAHNAVLTPFTQPLSQYGLTPPVIAFIWQGSDELLSDPACLAGMHTLREQGYGAALAEYGEGYRQLAALSQLPLDRIYIPPEVIGLLPHPDAMVMVQLMLRLADKMAMRCCAQRVDSVQQFECLSAAGCCDFQGSYLFRPLSAHQLAVVCHMLSDADEEESSSGG

Download

Sequence (FASTA)