Domain assignment for gi|238919760|ref|YP_002933275.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
118 371 S-adenosyl-L-methionine-dependent methyltransferases 1.7e-76 Mycolic acid cyclopropane synthase 0.0000282 1kpg A: Alignments

Protein Sequence Details

Sequence length 384
Comment Cyclopropane-fatty-acyl-phospholipid synthase [Edwardsiella ictaluri 93-146]
Sequence
MSSATCIEESELKQDNWYRIAEEMLSRAGITINGNQPYDLQVKNPQFFHRVLQEGSLGLGESYMDGWWECERLDIFFQRILTAGLDTQLPKHIADIARIASARIFNLQSRKRAWIVGKEHYDLGNDLFSRMLDPQMQYSCAYWKTAQTLEQAQQDKLKLICEKLRLQPGMRLLDIGCGWGGLAQYAAENYGVSVDGVTISAEQQKMAQARCQGLDVKILLQDYRDLNNRYDRIVSVGMFEHVGPKNYRTYFEVAARNLKADGLFLLHTIGSNQTDLNVDAWINKYIFPNGCLPSVAHIANYSEGLFVMEDWHSFGPDYDCTLMAWHQRFQACWPEISANYSERFYRMFCYYLTACAGAFRARNIQLWQVLLSPQGIEGGMRVPR

Download

Sequence (FASTA)