Domain assignment for gi|238919744|ref|YP_002933259.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 354 PLP-dependent transferases 7.84e-79 AAT-like 0.0000000115 1lc5 A: Alignments

Protein Sequence Details

Sequence length 358
Comment threonine-phosphate decarboxylase, putative [Edwardsiella ictaluri 93-146]
Sequence
MLHSQHGGDVIGVAERLGVSALNLTDFSANINPLGMPDSLRQALHHHLSLAQPYPDIEYRALYRALADHHGVDAGWIVAGNGETELIFALADALRPRRALLLTPGFAEYRRALQRVGCAIQTHPLKAGNGFQVDEDLLAALTADLDCLFICTPNNPTGLTPDPALLLVLAERCQHLGIRLIVDEAFWDFITDEAGMIPQLARFSCLCVLRSLTKFYAIAGLRLGYLLSADASLTARLRARQMPWSINAFAALAGEVVLRDRAYQQATHRWLAQERPFLYSALAALPSLQVWPGRANYLFLRCDRPQICLQQALLSHGLLIRRCADYPGLDPRYYRVCVRLRSDNLRLIAALRTCLCAG

Download

Sequence (FASTA)