Domain assignment for gi|238919723|ref|YP_002933238.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 263 P-loop containing nucleoside triphosphate hydrolases 1.41e-54 ABC transporter ATPase domain-like 0.00029 3dhw C:1-240 Alignments

Protein Sequence Details

Sequence length 331
Comment peptide transport system ATP-binding protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MPLLDIRNLTIEFMTPGGPVKAVDRVSLTLSEGEIRGLVGESGSGKSLIAKAICGVTKDNWRVTADRMRFDDIDLLRLSPRQRRRLVGHNVSMIFQEPQSCLDPSERIGRQLIQAIPGWTYKGRWWQRFHWRRRRAIELLHRVGIKDHRDAMRSLPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARMNQNNNTTILLISHDMQMMSKWADRINVMYCGQTVESASCEEILRAPHHPYTQALLRAMPDFGRSLPPKSRLNTLPGAIPSLEHLPIGCRLGPRCPYAQKKCIQTPTLRSVKNHSFACHFPLNMEEAQ

Download

Sequence (FASTA)