Domain assignment for gi|238919704|ref|YP_002933219.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 112 HIT-like 4.4e-35 HIT (HINT, histidine triad) family of protein kinase-interacting proteins 0.0001 1rzy A: Alignments

Protein Sequence Details

Sequence length 116
Comment histidine triad domain protein [Edwardsiella ictaluri 93-146]
Sequence
MAEETIFSKIIRGEIPADVVYQDDLVTAFRDISPQAPSHVLIVPNTLIPTVNDVQPQDEAALGRMISTAAKIARQEGVDESGYRLVINCNRDAGQEVFHIHMHLLGGRPLGPLLAR

Download

Sequence (FASTA)