Domain assignment for gi|238919626|ref|YP_002933141.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
24 122 Hypothetical protein YgiW 1.57e-18 Hypothetical protein YgiW 0.00067 1nnx A: Alignments

Protein Sequence Details

Sequence length 125
Comment protein of unknown function (DUF388) [Edwardsiella ictaluri 93-146]
Sequence
MNNAVKAVILALSVAGLTACSTSPQTSLGGGFDGPHQQNVMTVSQVQKSTVIDEGQMVQMRGHIVQALGGEDYRFRDDSGVMTLIVPGSAWAGRVVTPQQRVSVQGRIVKEFDGVKLYTVAIRLD

Download

Sequence (FASTA)