Domain assignment for gi|238919600|ref|YP_002933115.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
62 110 Homeodomain-like 0.0000000000000363 AraC type transcriptional activator 0.0055 1bl0 A:63-124 Alignments
11 59 Homeodomain-like 0.00000000188 AraC type transcriptional activator 0.0026 1d5y A:3-56 Alignments

Protein Sequence Details

Sequence length 132
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MTQQQRNAALVCALSEWIERHLGRDIYLDELARYSGYSLWHMQKIFRETTGMSLGRYIRLRKLTGAARRLRHSDEGIIDIALCYGFASQSHFTYMFRKHFGMTPTRYRLQAEQPTTPAPALHHQYAAAAQSA

Download

Sequence (FASTA)