Domain assignment for gi|238919565|ref|YP_002933080.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 141 P-loop containing nucleoside triphosphate hydrolases 2.78e-40 Type II thymidine kinase 0.0059 1xx6 A:2-142 Alignments
142 189 Glucocorticoid receptor-like (DNA-binding domain) 1.85e-17 Type II thymidine kinase zinc finger 0.018 2b8t A:150-216 Alignments

Protein Sequence Details

Sequence length 195
Comment thymidine kinase, putative [Edwardsiella ictaluri 93-146]
Sequence
MAQLYFYYSAMNAGKSTALLQSSYNYRERGMHTLVFTAEIDNRYAVGQVSSRIGLHSPAMLYNQGTDLLAEIRQAHQQQCVHCVLVDESQFLTKAQVLALSMVVDDLDIPVLCYGLRTDFRAELFPGSQYLLAWADKLVELKTICHCGRKANMVLRLDQDGRALKDGEQVVIGGNERYVSVCRRHYKEMLGVTSR

Download

Sequence (FASTA)