Domain assignment for gi|238919551|ref|YP_002933066.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 181 FMN-dependent nitroreductase-like 1.7e-41 NADH oxidase/flavin reductase 0.0092 1nox A: Alignments

Protein Sequence Details

Sequence length 182
Comment nitroreductase family protein [Edwardsiella ictaluri 93-146]
Sequence
MDALELLLQRRSASRLSEPAPSGQALENIFQAGLRAPDHGGLQPWRFVTVQGDGRERLSALLHDIALAGGSDEKGVEKARSAPFRAPLIVTVIAHCNRDSRVPQWEQVASAGCAVMAMQMAAQAQGFNGIWRSGHWTEEPRVRQAFGCREQDVIVGFLYLGTPTLKAAKVQPLDSSAFVHRF

Download

Sequence (FASTA)