Domain assignment for gi|238919524|ref|YP_002933039.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 211 Ribonuclease H-like 2.78e-64 DnaQ-like 3'-5' exonuclease 0.000000256 1yt3 A:1-193 Alignments
195 302 HRDC-like 3.05e-26 RNase D C-terminal domains 0.0000694 1yt3 A:194-294 Alignments
297 370 HRDC-like 1.28e-20 RNase D C-terminal domains 0.00022 1yt3 A:295-375 Alignments

Protein Sequence Details

Sequence length 371
Comment ribonuclease D, putative [Edwardsiella ictaluri 93-146]
Sequence
MLKYQLITSSSALKEVCERASACPYIALDTEFVRTRTYYPQLGLVQLYDGEMLSLIDPLTISDWQPFVDLLRNPQVVKLLHASSEDLEVFLHDFQTLPQPLIDTQILAAFSGRPLSSGFAAMVSAYLQVDLDKSESRTDWLARPLSERQCDYAAADVYYLLPMAHKLLAEVEACGWLPSALDECQALCRRRAETADPALVYREMTNAWQLRPRQLACLQLLGEWRLNQARARDMAVNFVVREESLWLVARYMPGSMAELSEIGVSGPEIRYHGKALLEIVGRSAALEEAQLPPTVGRLIDHPGYKQAFKYIKTLVQQVAEQQGLTAELLASRRQINQLLSVHWQLKAEQPDLLSGWRGQLLADGLNDMLKK

Download

Sequence (FASTA)