Domain assignment for gi|238919510|ref|YP_002933025.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
95 279 SIS domain 7.05e-41 mono-SIS domain 0.005 1vim A: Alignments
1 80 Homeodomain-like 4.66e-21 RpiR-like 0.0028 2o3f A:1-83 Alignments

Protein Sequence Details

Sequence length 289
Comment transcriptional regulator, RpiR family [Edwardsiella ictaluri 93-146]
Sequence
MNTLEKIQANLDQLSKSERKVAEVILAVPQTAIHSSIATLAKMADVSEPTVNRFCRRLETKGFPDFKLHLAQSLANGTPYVNRNVEENDSVDAYTSKIFESAMAGLEMAKNHLDMVTINRAVDLLTQAKKISFFGLGASAAVAHDAMNKFFRFNIPVVYFDDIVMQRMSCMNSNEGDVVVLISHTGRTKSLVEMAHLARENDATVIAITSRDTPLALEASLALLLDVPEDTDVYMPMVSRLAQLTLVDALATGFTLRRGAKFRDNLKRVKEALKESRFDKSIALPAHFE

Download

Sequence (FASTA)