Domain assignment for gi|238919492|ref|YP_002933007.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
88 316 S-adenosyl-L-methionine-dependent methyltransferases 7.7e-34 Arginine methyltransferase 0.082 2fyt A:238-548 Alignments

Protein Sequence Details

Sequence length 323
Comment methyltransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MIDFGNFYAQIAHGPLSKWLEVLPAQLAAWQRDSLHGYFRDWNNAVERLPALTPHRLDLLHGVCAGAETPLSEGQRIGIEKMLRTLMPWRKGPFELYGIQIDTEWRSDWKWQRILPHLSPLAGRTILDVGCGSGYHLWRMVGAGAHLAVGIDPMQLFLCQFEAVRKLLGGDSRAHLLPLGIEQLPALAAFDTVFSMGVLYHRRSPLDHLYQLKNQLVSGGELLLETLVIEGDEQQALIPGERYAQMRNVYFIPSAAMLIRWLEKCGFCDVRLVDQCPTSVEEQRRTDWMTSESLADFLDPADVRKTLEGYPAPLRAAFIARKP

Download

Sequence (FASTA)