Domain assignment for gi|238919368|ref|YP_002932883.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
232 513 Methyl-accepting chemotaxis protein (MCP) signaling domain 1.7e-77 Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000000421 1qu7 A: Alignments
25 169 Aspartate receptor, ligand-binding domain 3.66e-32 Aspartate receptor, ligand-binding domain 0.0027 2lig A: Alignments

Protein Sequence Details

Sequence length 532
Comment methyl-accepting chemotaxis protein IV [Edwardsiella ictaluri 93-146]
Sequence
MFNRIRISTSLFVLVLAFCFLQLSSNGVSFMAIRSDSDNYARVQLSNAQRERLGQTWVALLQARNTLNRAGTRVALHIPQEQIDALMYRVRAMLKKADGTMQQYMVYSDGNDEERALSQDTQQHYRALRTALLQLIDLVEKGDLQGFMDHPTQQIQDQFEASVAKLTQHVEGELKEGAEINHRSYQLSMVLNLTAVVLLVLLVLIAIWWLRNMLLAPLTLMRTHFERIARGDLSAEIKVDGRNEISQLYASLRSMQQDLAGTVLSVRQGTDAIYTGLQEIGAGNNDLSSRTEQQAASLEETAASMEQLTATVKQNADNARQASQLAQEASHTASEGGEIVSQVVRTMHNITQSSQKIGDITGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAKEIKGLIEESVSRVKQGSTQVEHAGNTMDNVVRSVVRVTDIMGEISSASEEQSRGIEQVALAVTQMDQVTQQNAALVEEAASATQSLEAQADVLTRAVATFRLGGDADAAQSDLQGHANGMS

Download

Sequence (FASTA)