Domain assignment for gi|238919319|ref|YP_002932834.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
6 417 MFS general substrate transporter 3.53e-71 Glycerol-3-phosphate transporter 0.000000808 1pw4 A: Alignments

Protein Sequence Details

Sequence length 431
Comment transporter, major facilitator family [Edwardsiella ictaluri 93-146]
Sequence
MNNIDKIYKQLRWQIIITTFLTYTVMYISRKAFAAAAPLLMQDIGMTAVQFGTASSIYYILYGISKFSSGLLADRINPRLFLAPVLLIVAVINVGIGMSNNVTVLLSLYCLTAIAQGCGFPPIAKAISQWYSKSERGGWYSLWNTSHNVGGALAPLIASGVIEYTGNWRYAFYVPAAITAVQAIISAIFMRAKPEKYGLPNVGEWKKDTKQLAINQRSEGGLTMWAMFTRYIVNNPIIWMAIGGDLCIYVIRTVTNDWVSVYFVKELGWDLVKSNSLVAWFEVGGILGGLTSGIISDRLFNADRWKTILIYTFVLIAGMVGVALTIHVHYYLVAICFFIIGAGIYAPQMLFALGIIEASHADGAGAATGLKGGVTYIGAAMAGAPIALIERAYSWNGVFVLMAAIAVLLVLLTIGIIGVDKRYNSKKAATR

Download

Sequence (FASTA)