Domain assignment for gi|238919312|ref|YP_002932827.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
78 391 S-adenosyl-L-methionine-dependent methyltransferases 2.76e-69 hypothetical RNA methyltransferase 0.00000525 1wxx A:65-382 Alignments
1 71 PUA domain-like 3.98e-17 Hypothetical RNA methyltransferase domain (HRMD) 0.0079 2as0 A:1-72 Alignments

Protein Sequence Details

Sequence length 405
Comment hypothetical protein NT01EI_1402 [Edwardsiella ictaluri 93-146]
Sequence
MARLILAKGREKSLLRRHPWIFSGAVARIEGNAASGETLDVCDHQGKWLARAAYSPQSQIRARVWSFDRDESIDRAFFERRLQQAQRWRDWLAGRDDLTGYRLIAGESDGMPGITIDRFQDTLVLQLLSAGAEYQRAALLDALHALYPQCAVYDRSDVAVRKKEGLPLVQGPVSGALPPDLLPIREHGMQILVDIKGGHKTGFYLDQRDSRLAARRFARDARVLNCFSYTGAFAVSTLMGGCAHVTSVDTSQAALDIARQNVELNGLDLARADFLRDDVFQLLRRYRDEGTTFDLIVMDPPKFVENKNQLAGACRGYKDINMLALQLLRPGGILLTFSCSGLMPTDLFQKILADAAVDAGRDIQFIEQYRQAADHPVIASYPEGLYLKGFACRVMGDLGTRGQLG

Download

Sequence (FASTA)