Domain assignment for gi|238919302|ref|YP_002932817.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
22 199 OMPA-like 9.94e-38 Outer membrane protein 0.000000902 1g90 A: Alignments
217 341 OmpA-like 8.37e-33 OmpA-like 0.00015 1r1m A: Alignments

Protein Sequence Details

Sequence length 353
Comment OmpA family protein [Edwardsiella ictaluri 93-146]
Sequence
MKKTAIALAVALAGFATVAQAAPKDDTWYVGGKLGWSHFISNSFEDMGTTKSHPNQLGAGAFFGYQANPYLGFEMGYDWLGRMSYTGDVNAKFKSQGVQLAAKLSYPLMDNLDVYTRLGGMVWRSDIHGAANGGEYTSSHDTGVSPLAAIGVEYALNKDWATRLDYQYVNKVGTSSETGARPDNTMLSLGVVYRFGQNEVAAPAPIPAPAPAPAPIVETKRFTLKSDVLFNFNKFTLKAEGRQALDQLYSQLSSMDPKEGSVVVLGYTDRIGSDQYNLKLSKQRAQTVVDYLVSKGIPANKIAARGMGKADPVTGSTCDNVKPRASLINCLAPDRRVVIEVKGTKEEVSQPQA

Download

Sequence (FASTA)