Domain assignment for gi|238919294|ref|YP_002932809.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 241 P-loop containing nucleoside triphosphate hydrolases 2.92e-48 ABC transporter ATPase domain-like 0.0014 1oxs C:1-242 Alignments
311 502 P-loop containing nucleoside triphosphate hydrolases 6.55e-47 ABC transporter ATPase domain-like 0.001 1g29 1:1-240 Alignments

Protein Sequence Details

Sequence length 637
Comment ABC transporter ATP-binding protein, putative [Edwardsiella ictaluri 93-146]
Sequence
MSLISLSGAWLSFSDAPLLDNAELHIEPNERVCLVGRNGAGKSTLLKILGREQALDDGRVVYAQDLVVSRLQQDPPRDVAGSVFDFVAGGVAEQAQHLRDYHELLRKVERDPSEQHLRQLAELQERLEHQGIWRMDARIRDVLTKLGLEADSPLSALSGGWLRKAALARALVCEPDVLLLDEPTNHLDIDTITWLEGFLKEFGGSIIFISHDRAFIRAMATRIVDLDRGKLVSWPGDYDAYLTGKEEALRVEELQNAEFDRRLAQEEAWIRQGIKARRTRNEGRVRALKSMRQEHAQRRAQQGSARMQAEEALRSGKIVFELENVSYHCGDKTLVRDFSGQVLRGDKIALVGANGCGKTTLLKLMLGQLNPDSGSVRCGTKLEIAYFDQHRAELDPDRTVMDNLAEGKQEVMVNGRARHVLGYLQDFLFHPKRAMTPVRALSGGERNRLLLARLFLKPSNLLVLDEPTNDLDIETLELLEELVANYPGTVLLVSHDRQFVDNCVTDCWIFEGDGVIARYTGGYADAHQQQAASQALRQPTATDAAPQAQKAEAKTERRRSSNKLSYNQLRELEQLPQQIEAQEEQLAALQAQVASPDFFSLPHGETQPVLQALAECEQTLEQAYARWESLETQKNAS

Download

Sequence (FASTA)