Domain assignment for gi|238919267|ref|YP_002932782.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 397 PLP-dependent transferases 8.91e-117 AAT-like 0.0000000000133 1qis A: Alignments

Protein Sequence Details

Sequence length 397
Comment aspartate aminotransferase [Edwardsiella ictaluri 93-146]
Sequence
MFENIPAAPADPILGLADLFRADARPHKINLGIGVYKDENGNTPVLTSVKKAERYLLEHETSKNYLSIEGIAAFGQRTLELLLGGDNPIISAGRAHAAQTPGGTGALRVAADFLASKTSAKRIWVSNPSWPNHKSVFSAAGLEVCEYAYYDAENHCLDFAALQDSLSQAQPGDVVLFHGCCHNPTGIDPTTAQWEALAEMSRNSGWLPLFDFAYQGFANGLEEDAQGLRIFAARHAELIVCSSYSKNFGLYNERVGACTLIAADRDNATNAFSQIKAVIRANYSNPPAHGGAVVATILGNDTLRAIWEQELTDMRQRIQRMRQLFVNTLQEKGAERDFSFIIHQNGMFSFSGLTKEQVGRLRDEFGVYAVSSGRINVAGMTPDNMAPLCEAIVAVLK

Download

Sequence (FASTA)