Domain assignment for gi|238919241|ref|YP_002932756.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
126 191 Ribonuclease H-like 0.000000000000417 Retroviral integrase, catalytic domain 0.041 1asu A: Alignments

Protein Sequence Details

Sequence length 221
Comment transposase [Edwardsiella ictaluri 93-146]
Sequence
MQKITPLLDILCGSHGVGPVCHELNIAPSIYYRYQNYHQQPETRSQRDRRDDHLKLEMEIQRVYDENYRVYDIRKVWRQLQRAGSSVARCTIARLMKNMGLTGVLRGKKLRTTVSRREAVAGERVNRQFVAERPNQLWVADFTFVRTWQGFAYEAFIIDVFAGAIVGWRVSSSMETTFVRDALEPALWARRLSQRQRLAVHTATAGSGAFGFNRDPVHDSV

Download

Sequence (FASTA)