Domain assignment for gi|238919224|ref|YP_002932739.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 361 UDP-Glycosyltransferase/glycogen phosphorylase 1.26e-76 Glycosyl transferases group 1 0.0014 2bis A:1-437 Alignments

Protein Sequence Details

Sequence length 366
Comment glycosyl transferase, group 1 family protein [Edwardsiella ictaluri 93-146]
Sequence
MKILYVITGLGLGGAEKQLSLLADNFTARGEQVSIVYLTGEVLVKPKNKNIKIYNLGIDKSFSSLIKGIWKLKSIISDVRPDVIHSHMYHANILARISCCLSLFSSRLVCSAHNKNEGGRVRMIIYRMTDFLCAKTTNVSQEALDEFITKKAFRKRKSSLVYNGIDLSIFKKKSTNIQNIKNKLGINFDEKVIFCAGRLTEAKDYPNLILAISKMHQKKCKIIIAGDGPMRSDIERLIDRCHLSHRILLIGIIDNISDYYNLSDLFVLPSRWEGFGLVVAEAMACECPVIATDAGGVAEVLSNADWLVPIADSSKLAEKIDEFFLLDSSEVKDIKAKNKDHCENQFSIGAIINNWYAIYNGIRSKL

Download

Sequence (FASTA)