Domain assignment for gi|238919171|ref|YP_002932685.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
11 167 Duplicated hybrid motif 1.1e-55 Glucose permease-like 0.000000123 1gla F: Alignments

Protein Sequence Details

Sequence length 169
Comment PTS system, glucose subfamily, IIA component [Edwardsiella ictaluri 93-146]
Sequence
MGLFDKLKSLVSDDKKEMGSIEIFAPLSGEIVNIEDVPDVVFAEKIVGDGIAIKPTGDKMVAPVDGTIGKIFETNHAFSIESDSGVELFVHFGIDTVELKGEGFKRIAEEGQRVKKGDVVIEFNLPLLEEKAKSTLTPVVISNMDEIKELIKLSGDVIVGETPVIRIKK

Download

Sequence (FASTA)