Domain assignment for gi|238919128|ref|YP_002932642.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
91 179 ACT-like 1.83e-16 Glycine cleavage system transcriptional repressor 0.0039 1u8s A:88-180 Alignments
6 86 ACT-like 0.00000000000000383 Glycine cleavage system transcriptional repressor 0.00087 1u8s A:2-87 Alignments

Protein Sequence Details

Sequence length 185
Comment hypothetical protein NT01EI_1199 [Edwardsiella ictaluri 93-146]
Sequence
MPQPNQHYLVITALGADRSGIVNNITRHVSSCGCNIEDSRLAMLGEEFTFIMLLSGSWNAITLIESTLPLKGVEMDLLIVMKRTTWHERPTMPATVWVQVEVKDSPHIIERFTDLFDSQRMNIAELVSRTQTREGSDEQQLYIQITAHSPASQDPTLIERAFNQLCLELNAQGSINVVNYSQHDG

Download

Sequence (FASTA)