Domain assignment for gi|238919108|ref|YP_002932622.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 154 Probable bacterial effector-binding domain 3.14e-28 Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0002 1jyh A: Alignments

Protein Sequence Details

Sequence length 155
Comment Bacterial transcription activator, effector binding domain protein; putative [Edwardsiella ictaluri 93-146]
Sequence
MQVRIVSLAAQPLFVLRVQGPFAQSLGPGFERLMAWSARHGLRGQWMALYYDNPREVAPDALRADVALTTASVTLPSDGEAYGIRRGALAGGLYALAQVRVTDNDFATPWIALFDQALPACGYRPDGGPCFERYLSDGRGSGEWLLELGVPVRKN

Download

Sequence (FASTA)