Domain assignment for gi|238919097|ref|YP_002932611.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
287 453 ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 9.04e-41 Histidine kinase 0.0029 2c2a A:321-481 Alignments
217 298 Homodimeric domain of signal transducing histidine kinase 0.00000000000000785 Homodimeric domain of signal transducing histidine kinase 0.0032 2c2a A:232-320 Alignments
182 230 HAMP domain-like 0.00000000017 HAMP domain 0.006 2asx A:278-331 Alignments

Protein Sequence Details

Sequence length 457
Comment signal transduction histidine-protein kinase BaeS, putative [Edwardsiella ictaluri 93-146]
Sequence
MRLGISAKLFLAILSTCILVLIIMHWGVRVSFERGFIDYIRHGNEQRVQLMASELETLYAREGNWSFLRHNERMIFRIMRDIEQSSNLHGSLPPHGWRTPFWVIDANGRRLVGPQGSLPNDGIRSAIRYQGRDVGWVLTTPPERLTRNTDINFDRQQRRTSWFIVALATLLAAAVTLLLSRGMLAPVKRLIDAMHQLAAGNFATRVDVSSRDELGRLAQDFNQLATTLERNEQIRRALMADVSHELRTPLAVLRGELEALQDGVRRLTPDSLTSLQAEVSTLTKLVNDLHQLSLSDAGALAYRKSPIEVSALVQAAAGAFRDRLAAKGIRLTLRLPHEARVFGDPDRLLQMFNNLLENSLRYTDSGGELQIVGQKSSDTLTLCWQDSAPGVSTEQLQHIFERFYRTEGSRSRSSGGSGLGLSICQNIVAAHGGRLSASHSPLGGVAMTVTLPLEAPP

Download

Sequence (FASTA)