Domain assignment for gi|238919082|ref|YP_002932596.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
14 260 Ribokinase-like 9e-60 Thiamin biosynthesis kinases 0.00000987 1v8a A: Alignments

Protein Sequence Details

Sequence length 267
Comment hydroxyethylthiazole kinase, putative [Edwardsiella ictaluri 93-146]
Sequence
MLTQPTPLPDALCAQALMTLRQRAPLVHCLTNEVVQSLTANVLLALGAAPAMVVQAEEARQFAALADALLINIGTLYDTRANSMLAAIESANLAGTPWVLDPVAVGALRYRSDFAHRLLRLRPAVIRGNASEILALAGAPSRGRGVDSQDDALAALPAAAALARDSGAVVAITGASDYVTDGHNSYRIDGGDPLMTQVVGTGCALSAVAAAFSVLDDRLTAVASACRVMALAGQRAAAQASGPGSFTPHFLDALYGLQPAVIAGEGA

Download

Sequence (FASTA)