Domain assignment for gi|238919032|ref|YP_002932546.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
2 79 Homeodomain-like 8.21e-22 Tetracyclin repressor-like, N-terminal domain 0.0025 1ui5 A:5-75 Alignments
84 202 Tetracyclin repressor-like, C-terminal domain 0.0000000122 Tetracyclin repressor-like, C-terminal domain 0.013 2g3b A:74-189 Alignments

Protein Sequence Details

Sequence length 237
Comment transcriptional regulator, TetR family [Edwardsiella ictaluri 93-146]
Sequence
MARKTKQQAQETRQQILDAAIREFSARGVAATSLNDIANAAGVTRGAIYWHFKNKTDIFHAVWEFMESRLSELELEYQTKFPDDPLRILRELLIFILVATVVDPQRRAMMEILYHKCEFVGEMRALGERRKLMYLESYTRIERVLQHCVFREQLPSNLDMLRSAIALRSYITGIMESWLFTPERFDLQQQAIPLVDNVIAMLQHSPFLRRDAACAPNDTSVWESGFPAMLNSVDKDE

Download

Sequence (FASTA)