Domain assignment for gi|238918986|ref|YP_002932500.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
8 389 PLP-dependent transferases 8.11e-84 Cystathionine synthase-like 0.0000198 1c7n A: Alignments

Protein Sequence Details

Sequence length 394
Comment aminotransferase, putative [Edwardsiella ictaluri 93-146]
Sequence
MEQNTFIEKYFTPRRHTDSVKWDGLQERFGDDNLLAMWVADMDFRSPDAVTEALLQRAQHGVFGYSQIPEAYFQAFIQWQQQRHRYPVQRTWLRYTPGVVTGLYWLINAFSHPGDAVMVNTPVYYPFLQAIRDCGRTLITSDLVNHQGHYSMDFANMAEKIAANRVRLFILCSPHNPVGRVWQEQELAQLLTLCEQHNVLVISDEIHQDLVLDGQHQPSATVDDGAFRARILTFAAASKTFNLAGLKNAFLIVEPPALRETFDDYAGRVVHTTNGSLLGYYAIAAAYRHGADWLQQVLSIIRSNYGYIDTTLRRTLPLIQISPLQGTYLMWIDLRAYCSDEELPQRIQQRGRLAVDYGAWFGDAGRGFIRLNIATSPEYIRQAVDNIIMALKPS

Download

Sequence (FASTA)