Domain assignment for gi|238918976|ref|YP_002932490.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
157 399 P-loop containing nucleoside triphosphate hydrolases 2.01e-66 Extended AAA-ATPase domain 0.00000301 1ny5 A:138-384 Alignments
369 458 Homeodomain-like 0.00000000000224 FIS-like 0.016 1eto B: Alignments

Protein Sequence Details

Sequence length 458
Comment hypothetical protein NT01EI_1043 [Edwardsiella ictaluri 93-146]
Sequence
MPDTTTDHAFSSCKNATALSSLLTDSLLREWLAQMSAMGAGIAIMCPDLHLLHTVGIDFQPGAWLPETTAATAAARVVPGHPVAWLSPEEHHLACLRDWASYAWLHTPSQGGAYILCILLPAHLYSPVFLLMMHHFRRRLSPVRHTLSPDTPAIQDGLIGQSPAFLRARDIMLRVAGGNSSIMLNGESGTGKELFARAIHRHSPRAGHPFIAINCSAIPAGLISSELFGYRDGAFTGARRGGASGVFESAHGGTLLLDEVGELPLDAQAILLRVLEERTVVRLGDTRGIPIDVRIITATNRDLAQMVREHTFRQDLYYRLNVIPITLPPLRQRPQDIPLLAHFFLTSLGGSRMTAIEAEAMARLCASQWPGNIRQLRNVIEWGINFADGNILRCADLPPDLDLPDTPPADGQADSYAAWERRQIWALMQRYRANKTRIAQVLGISRGTLYKKIRHYGL

Download

Sequence (FASTA)