Domain assignment for gi|238918932|ref|YP_002932446.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
100 302 Periplasmic binding protein-like II 1.25e-23 Phosphate binding protein-like 0.0073 2esn A:92-303 Alignments
13 95 "Winged helix" DNA-binding domain 2.61e-17 LysR-like transcriptional regulators 0.0061 1ixc A:1-89 Alignments

Protein Sequence Details

Sequence length 308
Comment LysR substrate binding domain protein [Edwardsiella ictaluri 93-146]
Sequence
MERVGYGQGHNIETKWLYDFLTLEECRNFSQAAMRRNVSQSAFSRRIQSLEQACGVVLFDRSISPLQLTGQGKIFHSQVRSLLQQLESNLAGLRSGGDPAQQRIAIAAAHSLSLGLLPSLVKRLPTPFSYTVEAIDVDRAVDTLREGKSDFIFSYHDDNLLQTPFAHIHLFSSQLFPVCAADRLGQPLYRLDQADAPLLNYTANSYMGRQVNRVLARDTSLNFRTVFVSSMSELLKQVALDGSGIAWLPGYGIRQELAQGRLVALDSQALLIPIDAYAYRLDTRLSQSMERFWQLLGELFSARAGEME

Download

Sequence (FASTA)