Domain assignment for gi|238918927|ref|YP_002932441.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 216 FMN-dependent nitroreductase-like 5.23e-61 NADH oxidase/flavin reductase 0.000000146 1nec A: Alignments

Protein Sequence Details

Sequence length 217
Comment Oxygen-insensitive NAD(P)H nitroreductase, putative [Edwardsiella ictaluri 93-146]
Sequence
MDIISAAQSRYSTKVFDADRKLSRGDLDSVKALLRLSPSSTNSQPWHFILAGSDAGKARIASTTVGSYEFNRCKVLEASHVVVFCAKTEIDEAYLQRLLQQEQADGRFATPQAMEAQHKGRAYFASMHRDTLQDAGQWMTRQVYLNLGNFLLGLAALHIDAVPIEGFDSAALDAEFGLPQQGLTSVVLVALGYHSAEDFNAALPKSRLPLSEILTEC

Download

Sequence (FASTA)