Domain assignment for gi|238918874|ref|YP_002932388.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
98 147 Homeodomain-like 0.000000000000538 AraC type transcriptional activator 0.0093 1d5y A:57-121 Alignments
51 95 Homeodomain-like 0.0000108 AraC type transcriptional activator 0.036 1bl0 A:63-124 Alignments

Protein Sequence Details

Sequence length 153
Comment transcriptional regulator, AraC family [Edwardsiella ictaluri 93-146]
Sequence
MAPGLLKTLLRLADADDETMLRLVLAYSLTLECQRTSTLLRSLLTADADLFDTLYRHRLEPWPVARYADLFGLSQRKFNQLFNEKFGMAPKRWLLRQRLGHARQLLETTSKKVIDVALESGFCNAAHFSDCFRRHFSQSPSEVRRASHHHRAA

Download

Sequence (FASTA)