Domain assignment for gi|238918859|ref|YP_002932373.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 73 Homeodomain-like 0.0000000000000161 Cgl2762-like 0.075 2jn6 A:1-89 Alignments

Protein Sequence Details

Sequence length 88
Comment transposase, IS3/IS911 family protein [Edwardsiella ictaluri 93-146]
Sequence
MRKARFTEHQIIAVMKSVEAGRTIKDVCREAGISEATYYNWKSRYGGMEASDIKKIKDLEDENRRLKQMFADLSLENRALKDVIEKKL

Download

Sequence (FASTA)