Domain assignment for gi|238918832|ref|YP_002932346.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
35 342 ApbE-like 2.41e-101 ApbE-like 0.0000453 1vrm A:44-352 Alignments

Protein Sequence Details

Sequence length 348
Comment ApbE family protein [Edwardsiella ictaluri 93-146]
Sequence
MMKHQSTGHGPMTRFLALLTAVLLLSGCGPTQVDLAGKTMGTYYAVKYVGVDGAPAPAVVQAEIDRRLERVNDQMSTYRPGSELSRFNQSRTVDVPFPVSTDTARVVKEALRINKLTDGALDITVGPLVNLWGFGPEGRPDREPAAAQIAQRRAWVGIQHLSLQGNALVKDIPQLYVDLSAIAKGYGVDVVARYLQSLHIENYMVDIGGEVRTKGDNGEGVPWRIAIEKPSGDAQQQVQTIIQPGQMAIATSGDYRNYFEQDGLRFSHEIDPNTGRPVTHRLASITVLAPTCMTADGLSTGLFVMGPDRAMALANQMHIPVYMIVKGEHGFEERASAAFNAYRAPGKP

Download

Sequence (FASTA)