Domain assignment for gi|238918792|ref|YP_002932306.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
3 127 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 2.82e-30 Antibiotic resistance proteins 0.015 1lqp A: Alignments

Protein Sequence Details

Sequence length 139
Comment glyoxalase family protein [Edwardsiella ictaluri 93-146]
Sequence
MQLNRLHHIALIASDYARSKAFYCDILGFSLVNEHYRAERDSWKGDLALNGVYTLELFSFPAPPPRVSTPEACGLRHLAFSVTDLALAVAHLASLGVTCEPIRCDEYTGRSFTFFRDPDGLPLELYQELLVKKTVSIVN

Download

Sequence (FASTA)