Domain assignment for gi|238918762|ref|YP_002932276.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
4 159 PIN domain-like 7.85e-37 5' to 3' exonuclease catalytic domain 0.00067 1bgx T:1-173 Alignments
160 244 5' to 3' exonuclease, C-terminal subdomain 3.29e-22 5' to 3' exonuclease, C-terminal subdomain 0.00083 1bgx T:174-289 Alignments

Protein Sequence Details

Sequence length 253
Comment 5'-3' exonuclease, C-terminal SAM fold protein [Edwardsiella ictaluri 93-146]
Sequence
MSIHLLIVDALNLIRRIHAVQGSPCGDACSAALRQLVGHTTPSHAVAVFDQDDRAESWRHRLLPGYKAGRQAMPDALAQEMESLRAAFTAQGVACWHSPGNEADDLAATLAYKVAQGGHRVTIVSTDKGYCQLLSPQIQIRDYFQKRWLDLPFVQREFGVAPQQLTDFWGLAGIGSSKIPGISGIGAKTAAALLKEFGSLEALYQHLAQVPERWRQRLTEQREMAEICRRVATLQTDLALHGNLQQLRLNGRA

Download

Sequence (FASTA)