Domain assignment for gi|238918761|ref|YP_002932275.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
184 297 S-adenosyl-L-methionine-dependent methyltransferases 0.00000000000000705 RNA methyltransferase FtsJ 0.028 1ej0 A: Alignments

Protein Sequence Details

Sequence length 374
Comment hypothetical protein NT01EI_0823 [Edwardsiella ictaluri 93-146]
Sequence
MNRLALYCRPGFEKECAAEITDKAAALEVYGFARVKENSGYVLFECYQPDDADTLARKLPFRELIFARQMLVVGELLKDLPPEDRIAPICGMLLGVVEGGGELRVEVPDTNESKELLKFCRKFTVPLRAALREQRTLLRQENPYRPVVHVLFIAPGCCYVGYSYSDNNSPFYMGIPRLKFPADAPSRSTLKLEEAFHVFIPADEWDERLGSGMRAVDLGACPGGWTYQLVQRSMMVQAIDNGPMVPSLMETGQVTHHRADGFRFTPEGDNDWLVCDMVEKPAKVSALMARWLVNGWCREAIFNLKLPMKKRYEEVSQNLATLAQVLKENGINAQIAAKQLYHDREEVTVHVRRIWGAIPGRRDEREFRRREQRD

Download

Sequence (FASTA)