Domain assignment for gi|238918744|ref|YP_002932258.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
9 72 Pili subunits 0.0000000157 Pilin 0.012 2pil A: Alignments

Protein Sequence Details

Sequence length 161
Comment Prokaryotic N-terminal methylation motif protein [Edwardsiella ictaluri 93-146]
Sequence
MRDTPRGYTLLEVMLVCGLLALLAAAALPFWLPRRDQQQILAESLRLQAYLLTLREQAFRSNGVRHILLRRGSGGEACLVGQPQDDCRTVAAFVPIAPLRLEAQMSSDAGFYGVRNTARPGHIRLSDERRAVRVIWSAQGRVRLCAEYGLPVLTACDTSGE

Download

Sequence (FASTA)