Domain assignment for gi|238918743|ref|YP_002932257.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
1 264 Thymidylate synthase/dCMP hydroxymethylase 2.88e-127 Thymidylate synthase/dCMP hydroxymethylase 0.000000000385 1qqq A: Alignments

Protein Sequence Details

Sequence length 264
Comment thymidylate synthase, putative [Edwardsiella ictaluri 93-146]
Sequence
MKQYLDLMRKVLAEGTPKADRTGTGTLSIFGHQMRFNLQQGFPLVTTKKCHLRSIIHELLWFLNGETNVSYLHENNVTIWDEWADDNGDLGPVYGKQWRAWGCADGRQVDQISQVMEQLRQEPDSRRIIVSAWNVGELDQMALAPCHAFFQFYVADGRLSCQLYQRSCDVFLGLPFNIASYALLVHMMAQQLDLQVGDFVWTGGDTHLYSNHMEQTALQLTREPRALPRLVLARRPASIFDYRFEDFIIEGYDPHPAIKAPVAV

Download

Sequence (FASTA)