Domain assignment for gi|238918732|ref|YP_002932246.1| from Edwardsiella ictaluri 93-146

Other proteins with this domain architecture

See the phylogenetic distribution for this domain architecture

Domain Assignment Details

Start Residue End Residue Superfamily Superfamily E-value Family Family E-value Closest structure View
10 110 DnaK suppressor protein DksA, alpha-hairpin domain 3.27e-39 DnaK suppressor protein DksA, alpha-hairpin domain 0.00000225 1tjl A:7-110 Alignments
111 149 Glucocorticoid receptor-like (DNA-binding domain) 0.00000000057 Prokaryotic DksA/TraR C4-type zinc finger 0.00058 1tjl A:111-151 Alignments

Protein Sequence Details

Sequence length 151
Comment RNA polymerase-binding protein DksA, putative [Edwardsiella ictaluri 93-146]
Sequence
MQEGQNRKPSSLSILAIAGVEPYQEKPGEEYMNNAQLAHFKRILEAWRNQLRDEVDRTVSHMQEEAANFPDPADRATQEEEFSLELRNRDRERKLIKKIEKTLQKIEDDDFGFCESCGVEIGIRRLEARPTADLCIDCKTLAEIREKQMAG

Download

Sequence (FASTA)